hGH fragment raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-04-27 and is reviewed periodically as new material appears.
Proposed mechanism focuses on lipolysis, the breakdown of stored triglycerides into free fatty acids and glycerol. AOD-9604 is thought to act on adipose tissue without stimulating appetite or affecting blood sugar in the same way as growth hormone. Laboratory studies report increased fat oxidation in some models. The precise receptor interactions and signaling pathways remain incompletely characterized. Researchers have proposed that the peptide may influence fat mobilization through pathways distinct from the full hormone.
Research has examined whether the peptide affects fat mass independently of growth hormone's other actions. Early animal studies suggested reductions in body fat, but species differences and small sample sizes limit interpretation. Human studies have generally been short and have not consistently shown large effects. Some trials measured body composition, lipid profiles, and safety parameters, but the overall picture is one of suggestive yet inconclusive metabolic activity. Findings vary across study populations and protocols.
A central uncertainty is whether observed metabolic changes translate into meaningful clinical benefits. Study designs vary in dose, duration, and participant characteristics, making comparisons difficult. Independent replication is limited, and the field lacks consensus on optimal endpoints or treatment duration. Ongoing or future studies may clarify mechanism and effect size, but current evidence does not establish a clear therapeutic role. Researchers often call for larger, longer, and better-controlled trials, while questions remain about which patient groups might respond.
Laboratory studies have reported that AOD9604 can increase lipolysis and reduce lipid accumulation in fat cells. The precise molecular target remains uncertain, and the compound does not appear to activate the growth hormone receptor in the same way as full-length hGH. Proposed mechanisms include effects on beta-adrenergic signaling and enzymes involved in fatty acid synthesis, but these pathways are not firmly established. Because most evidence comes from cell and animal models, whether the same effects occur in humans is an open question.
Clinical development of AOD9604 included trials in people with obesity, but the results did not lead to approval as a prescription medicine in major markets. Interest later shifted to research settings and to unapproved products marketed for body composition. Regulatory agencies have questioned whether the peptide qualifies as a dietary ingredient, and some have issued warnings about its presence in supplements. Long-term human safety data are limited, and questions about efficacy, dosing, and target populations remain unresolved.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic peptide fragment | Not a full hormone |
| Molecular target | Proposed adipose tissue lipolysis | Receptor details uncertain |
| Typical research dose | Not established for clinical use | Doses vary across studies |
| Stability in solution | Limited; store cold | Avoid repeated freeze-thaw |
| Regulatory status | Not approved as a drug | Varies by country |
Quality varies among research-grade suppliers, so certificates of analysis and independent testing are important for verification. A typical certificate reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes residual solvents or water content. AOD9604 is often sold as a research chemical not intended for human consumption, and labels can be inaccurate. Common misconceptions include treating the peptide as a form of growth hormone, assuming supplement status, or expecting approved-drug quality from unregulated products.
AOD9604 is commonly supplied as a white to off-white lyophilized powder. The powder is typically stored at -20 °C or below, protected from light and moisture, because peptides can degrade through oxidation, hydrolysis, or aggregation. If it is reconstituted for laboratory use, an appropriate aqueous buffer or solvent is chosen, and the solution is kept cold and handled to avoid repeated freeze-thaw cycles. These practices support stability but do not imply suitability for human use.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography and mass spectrometry. Reversed-phase HPLC separates the peptide from related impurities and can estimate purity by ultraviolet absorbance, while mass spectrometry confirms the molecular mass and detects modifications. Peptide mapping, amino acid analysis, and disulfide mapping may be used when the sequence or disulfide arrangement must be verified. Because AOD9604 contains cysteine residues, oxidation and disulfide isomers are possible quality concerns in synthetic batches.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
Stability of AOD-9604 depends on storage conditions. Lyophilized powder is generally more stable than reconstituted solution. Recommended storage is typically at -20°C or lower, protected from light and moisture. Repeated freeze-thaw cycles can cause aggregation or degradation. In solution, the peptide may be susceptible to hydrolysis or oxidation, so aliquoting and cold storage are common practices. Researchers often add stabilizers such as mannitol or trehalose during lyophilization to improve shelf life.
Quality control for AOD-9604 involves verifying identity, purity, and concentration. Suppliers may provide a certificate of analysis listing HPLC purity and mass spectrometry data. Independent verification is advised because peptide products can vary in quality. Researchers should check for counterions, residual solvents, and microbial contamination. Proper documentation supports reproducibility and safety in laboratory studies. When sourcing, institutions often require third-party testing and detailed chain-of-custody records. These steps help ensure that experimental results are attributable to the peptide rather than impurities.
Analytical characterization of AOD-9604 typically employs reversed-phase high-performance liquid chromatography (RP-HPLC) to assess purity and identity. Mass spectrometry provides confirmation of molecular mass, while amino acid analysis can verify composition. These methods are standard for peptide research chemicals. Because the peptide lacks a distinct chromophore, detection often relies on ultraviolet absorbance at 214 nm or mass spectrometric response. Laboratories may also use capillary electrophoresis for separation. For example, size-exclusion chromatography can detect aggregates.
DHFR has been used as a tool to detect protein–protein interactions in a protein-fragment complementation assay (PCA), using a split-protein approach. DHFR-lacking CHO cells are the most commonly used cell line for the production of recombinant proteins. These cells are transfected with a plasmid carrying the dhfr gene and the gene for the recombinant protein in a single expression system, and then subjected to selective conditions in thymidine-lacking medium. Only the cells with the exogenous DHFR gene along with the gene of interest survive. Supplementation of this medium with methotrexate, a competitive inhibitor of DHFR, can further select for those cells expressing the highest levels of DHFR, and thus, select for the top recombinant protein producers. Dihydrofolate reductase has been shown to interact with GroEL and Mdm2. Click on genes, proteins and metabolites below to link to respective articles.
Alpha-synuclein has been shown to interact with Dopamine transporter, Parkin (ligase), Phospholipase D1, SNCAIP, Tau protein. Beta amyloid Synuclein Contursi Terme - the village in Italy where a mutation in the α-synuclein gene led to a family history of Parkinson's disease Anti-α-synuclein drug Media related to Alpha-synuclein at Wikimedia Commons alpha-Synuclein at the U.S. National Library of Medicine Medical Subject Headings (MeSH) Human SNCA genome location and SNCA gene details page in the UCSC Genome Browser.
Depending on the column size, CIM monolithic columns are primarily used for the purification or analysis of large biomolecules which are being used for cancer gene therapy, treatment of viral infectious diseases and treatment of genetic diseases. Some types of molecules that can be successfully purified using CIM columns are pDNA, IgM, inter-alpha inhibitors, virus like particles, and diverse viruses; adenoviruses, bacteriophages, feline calicivirus, hepatitis A, lentivirus, influenza A and B, rabies virus, rotavirus, tomato and pepino mosaic virus. Since 2004, BIA Separations has organized and hosted the Monolith Summer School and Symposium (MSS) which takes place every 2 years. MSS was established as there were no dedicated conferences to this technology and to bring together the top international scientists and researchers in the area of monolith chromatography to share their experiences and innovative applications. BIA Separations home page Monolith Events
ADP + Pi + 2H+out ⇌ ATP + H2O + 2H+in ATP synthase lies across a cellular membrane and forms an aperture that protons can cross from areas of high concentration to areas of low concentration, imparting energy for the synthesis of ATP. This electrochemical gradient is generated by the electron transport chain and allows cells to store energy in ATP for later use. In prokaryotic cells ATP synthase lies across the plasma membrane, while in eukaryotic cells it lies across the inner mitochondrial membrane. Organisms capable of photosynthesis also have ATP synthase across the thylakoid membrane, which in plants is located in the chloroplast and in cyanobacteria is located in the cytoplasm. ATP synthase is present in all organisms studied. Eukaryotic ATP synthases are F-ATPases (which usually work as ATP synthases instead of ATPases in cellular environments) and running "in reverse" for an ATPase (ATPases catalyze the decomposition of ATP into ADP and a free phosphate ion). This article deals mainly with this type. An F-ATPase consists of two main subunits, FO and F1, which has a rotational motor mechanism allowing for ATP production.
Sources: en.wikipedia.org
June 13 – 23: 2019 Men's Softball World Championship in Prague-Havlíčkův Brod Argentina defeated Japan, 3–2, to win their first Men's Softball World Championship title. Canada took third place. July 23 – 27: Europe/Africa Softball 2020 Olympic Qualifier in Utrecht Italy defeated Great Britain, 5–0, to book their team and compete at the 2020 Summer Olympics. July 26 – 30: 2019 Women's U12 Softball World Cup in Tainan (debut event) Chinese Taipei defeated Peru, 3–2, to win the inaugural Women's U12 Softball World Cup title. The Czech Republic took third place. Indonesia took fourth place. August 10 – 17: 2019 Women's U19 Softball World Cup in Irvine The United States defeated Japan, 4–3, to win their third consecutive and seventh overall Women's U19 Softball World Cup title. Canada took third place. August 25 – September 1: Americas Softball 2020 Olympic Qualifier in Surrey Champions: Mexico; Second: Canada; Third: Puerto Rico Note: Both Mexico and Canada have qualified to compete at the 2020 Summer Olympics. September 24 –28: Asia/Oceania Softball 2020 Olympic Qualifier in Shanghai Champions: Australia; Second: Chinese Taipei; Third: China Note: Australia has qualified to compete at the 2020 Summer Olympics.
January 19 – March 25: 2018 FIBA Americas League San Lorenzo defeated Mogi das Cruzes, 79–71, to win their first FIBA Americas League title. Regatas Corrientes took third place. June 11 – 16: 2018 FIBA Under-18 Americas Championship in St. Catharines The United States defeated Canada, 113–74, to win their fifth consecutive and ninth overall FIBA Under-18 Americas Championship title. Argentina took third place. August 1 – 7: 2018 FIBA Under-18 Women's Americas Championship in Mexico City The United States defeated Canada, 84–60, to win their ninth consecutive and tenth overall FIBA Under-18 Women's Americas Championship title. Argentina took third place.
Fatty change, or steatosis, is the accumulation of fatty acids in liver cells. This can be seen as fatty globules under the microscope. Alcoholism causes development of large fatty globules (macro-vesicular steatosis) throughout the liver and can begin to occur after a few days of heavy drinking. Alcohol is metabolized by alcohol dehydrogenase (ADH) into acetaldehyde, then further metabolized by aldehyde dehydrogenase (ALDH) into acetic acid, which is finally oxidized into carbon dioxide (CO2) and water (H2O). This process generates NADH, and increases the NADH/NAD+ ratio. A higher NADH concentration induces fatty acid synthesis while a decreased NAD level results in decreased fatty acid oxidation. Subsequently, the higher levels of fatty acids signal the liver cells to compound it to glycerol to form triglycerides. These triglycerides accumulate, resulting in fatty liver.
Alcohol dehydrogenase class-3 is an enzyme that in humans is encoded by the ADH5 gene. This gene encodes glutathione-dependent formaldehyde dehydrogenase or the class III alcohol dehydrogenase chi subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class III alcohol dehydrogenase is a homodimer composed of 2 chi subunits. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis.
Another common example is the reaction of a primary amine or secondary amine with a carboxylic acid or with a carboxylic acid derivative to form an amide. This reaction is widely used, especially in the synthesis of peptides. On the simple addition of an amine to a carboxylic acid, a salt of the organic acid and base is obtained. To overcome this, the carboxylic acid first needs to be "activated". This is usually done by converting the acid into a more reactive derivative (i.e. anhydride, acid halide) or by using a coupling agent. In some cases, high temperatures (>200 °C) can overcome salt formation by driving off water, without the need for "activation" of the carboxyl group. The downside to this simple reaction is that the compounds may decompose at these elevated temperatures. The carboxylic acid derivatives can be esters, anhydrides, acid halides or any other activated species. The choice of activated carboxyl group or coupling agent can be very important in peptide synthesis, as using the wrong one can lead to racemization.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
In the first decade of the 21st century, what was called "age management medicine" was considered a field of alternative medicine, and, as of 2007, was not recognized by the American Medical Association. Other names at this time included "antiaging medicine" and "regenerative medicine". Age management medicine is controversial. The field is underregulated and supported by insufficient scientific evidence. People who practice it open themselves up to legal liability on grounds of negligence–malpractice, warranty issues, and product liability. The use of growth hormone has been frequently recommended; however, such use is associated with cancer. Age management medicine is often promoted by anti-aging practitioners specializing in nutritional supplements and hormone-replacement, a practice that may lead to harmful side-effects.
Accumulation of amyloid proteins in the gastrointestinal system may be caused by a wide range of amyloid disorders and have different presentations depending on the degree of organ involvement. Potential symptoms include weight loss, diarrhea, abdominal pain, heartburn (gastrointestinal reflux), and GI bleeding. Amyloidosis may also affect accessory digestive organs including the liver, and may present with jaundice, fatty stool, anorexia, fluid buildup in the abdomen, and spleen enlargement. Accumulation of amyloid proteins in the liver can lead to elevations in serum aminotransferases and alkaline phosphatase, two biomarkers of liver injury, which is seen in about one third of people. Liver enlargement is common. In contrast, spleen enlargement is rare, occurring in 5% of people. Splenic dysfunction, leading to the presence of Howell-Jolly bodies on blood smear, occurs in 24% of people with amyloidosis. Malabsorption is seen in 8.5% of AL amyloidosis and 2.4% of AA amyloidosis. One suggested mechanism for the observed malabsorption is that amyloid deposits in the tips of intestinal villi (fingerlike projections that increase the intestinal area available for absorption of food), begin to erode the functionality of the villi, presenting a sprue-like picture.
Jonathan E. Mangum is an Australian biomedical scientist, entrepreneur, and executive known for his contributions to translational proteomics and the development of diagnostic technologies in oral health. He is a co-founder of Incisive Technologies and the scientific lead behind BlueCheck, a diagnostic tool for early detection of dental caries, which received FDA clearance in 2023. Mangum earned his Bachelor and Master of Science degrees in Biochemistry from the University of Otago in New Zealand (1995–2000). He completed a PhD in Biomedical Sciences at the University of Melbourne in 2013. He also holds a Graduate Certificate in Commercialisation from Melbourne Business School.
5β-Pregnane, also known as 17β-ethyletiocholane or as 10β,13β-dimethyl-17β-ethyl-5β-gonane, is a steroid and a parent compound of a variety of steroid derivatives. It is one of the epimers of pregnane, the other being 5α-pregnane. Derivatives of 5β-pregnane include the naturally occurring steroids 5β-dihydroprogesterone, pregnanolone, epipregnanolone, pregnanediol, and pregnanetriol, and the synthetic steroids hydroxydione, renanolone, ORG-20599, and SAGE-217. These derivatives include metabolites of progesterone and endogenous and synthetic neurosteroids. Etiocholane Gonane
Sources: en.wikipedia.org
It is proposed to promote lipolysis in fat tissue, the breakdown of stored fat into fatty acids and glycerol. The detailed receptor and signaling mechanisms are not fully established.
Because it is a fragment rather than full growth hormone, it is generally described as lacking growth-promoting effects. Some studies suggest it may influence fat metabolism without the same systemic growth effects, though evidence is limited.
Human trials have measured body weight, fat mass, lean mass, lipid levels, and adverse events. Most have been small or short-term, so conclusions about long-term outcomes are limited.
AOD9604 is a synthetic peptide based on a C-terminal segment of human growth hormone. It is manufactured by chemical peptide synthesis rather than extracted from human tissue. The sequence is often described as hGH fragment 176–191 or a close variant.